-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 950-1090 of human TRIM33 (NP_056990.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIM33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 950-1090 of human TRIM33 (NP_056990.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07499A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM33 |
| Target Synonyms | ECTO; PTC7; RFG7; TF1G; TIF1G; TIFGAMMA; TIF1GAMMA; TRIM33 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, MCF7, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 950-1090 of human TRIM33 (NP_056990.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLP | Uniprot ID | Q9UPN9 |
Uniprot Id
Q9UPN9
Target Species
Human
Target Name
TRIM33
Target Full Name
E3 ubiquitin-protein ligase TRIM33
Target Function
Acts as an E3 ubiquitin-protein ligase. Promotes SMAD4 ubiquitination, nuclear exclusion and degradation via the ubiquitin proteasome pathway. According to PubMed:16751102, does not promote a decrease in the level of endogenous SMAD4. May act as a transcriptional repressor. Inhibits the transcriptional response to TGF-beta/BMP signaling cascade. Plays a role in the control of cell proliferation. Its association with SMAD2 and SMAD3 stimulates erythroid differentiation of hematopoietic stem/progenitor. Monoubiquitinates SMAD4 and acts as an inhibitor of SMAD4-dependent TGF-beta/BMP signaling cascade (Monoubiquitination of SMAD4 hampers its ability to form a stable complex with activated SMAD2/3 resulting in inhibition of TGF-beta/BMP signaling cascade).
Target Involvement
A chromosomal aberration involving TRIM33 is found in papillary thyroid carcinomas (PTCs). Translocation t(1;10)(p13;q11) with RET. The translocation generates the TRIM33/RET (PTC7) oncogene.
Target Subcellular Location
Nucleus.
Target Protein Families
TRIM/RBCC family
Target Tissue Specificity
Expressed in stem cells at the bottom of the crypts of the colon (at protein level). Expressed in colon adenomas and adenocarcinomas (at protein level). Expressed in brain, lung, liver, spleen, thymus, prostate, kidney, testis, heart, placenta, pancreas,
Target Synonyms
8030451N04Rik; AI413936; cb1085; DKFZp586K1123; E3 ubiquitin-protein ligase TRIM33; EC 6.3.2.- ; Ectodermin; Ectodermin homolog; FLJ11429 ; FLJ32925; id:ibd2175; MGC136680; mKIAA1113; OTTHUMP00000013662 ; OTTHUMP00000013663 ; Protein Rfg7; PTC7; Ret fused gene 7; RET-fused gene 7 protein; RFG7; Rfg7 protein; TF1G; TIF1 gamma; TIF1-gamma; TIF1G ; TIF1GAMMA ; TIFGAMMA; Transcription intermediary factor 1-gamma; Transcriptional intermediary factor 1 gamma; TRI33_HUMAN; trim33; Tripartite motif containing 33; Tripartite motif containing 33 protein; tripartite motif-containing 33; Tripartite motif-containing protein 33; wu:fc17f10; zgc:136680
Target Background
The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.
Notification