Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM62 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human TRIM62 (NP_060677.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TRIM62 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human TRIM62 (NP_060677.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04787A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM62 |
| Target Synonyms | DEAR1; TRIM62 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human TRIM62 (NP_060677.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HEQHQVTGIDDAFDELQRELKDQLQALQDSEREHTEALQLLKRQLAETKSSTKSLRTTIGEAFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAETDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQY | Uniprot ID | Q9BVG3 |
Uniprot Id
Q9BVG3
Target Species
Human
Target Name
TRIM62
Target Full Name
E3 ubiquitin-protein ligase TRIM62
Target Function
E3 ubiquitin ligase that plays a role in antifungal immunity by mediating 'Lys-27'-linked ubiquitination of CARD9 downstream of C-type lectin receptors; leading to CARD9 activation, followed by activation of NF-kappa-B and MAP kinase p38 pathways. E3 ubiquitin ligase activity is dependent on E2 ubiquitin-conjugating enzyme UBE2D2.
Target Subcellular Location
Cytoplasm.
Target Protein Families
TRIM/RBCC family
Target Synonyms
6330414G21Rik; AI450348; DEAR1; ductal epithelium-associated RING Chromosome 1; E3 ubiquitin-protein ligase TRIM62; FLJ10759; FLJ16558 ; MGC115263; TRI62_HUMAN; TRIM62; Tripartite motif containing 62; Tripartite motif-containing protein 62
Target Background
Enables identical protein binding activity; transcription coactivator activity; and ubiquitin-protein transferase activity. Involved in several processes, including negative regulation of viral transcription; positive regulation of NF-kappaB transcription factor activity; and positive regulation of antifungal innate immune response. Is active in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
