-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPM8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 880-960 of human TRPM8 (NP_076985.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRPM8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 880-960 of human TRPM8 (NP_076985.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06324A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPM8 |
| Target Synonyms | TRPP8; LTRPC6; trp-p8; LTrpC-6; TRPM8 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 293T, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 880-960 of human TRPM8 (NP_076985.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV | Uniprot ID | Q7Z2W7 |
Uniprot Id
Q7Z2W7
Target Species
Human
Target Name
TRPM8
Target Full Name
Transient receptor potential cation channel subfamily M member 8
Target Function
Receptor-activated non-selective cation channel involved in detection of sensations such as coolness, by being activated by cold temperature below 25 degrees Celsius. Activated by icilin, eucalyptol, menthol, cold and modulation of intracellular pH. Involved in menthol sensation. Permeable for monovalent cations sodium, potassium, and cesium and divalent cation calcium. Temperature sensing is tightly linked to voltage-dependent gating. Activated upon depolarization, changes in temperature resulting in graded shifts of its voltage-dependent activation curves. The chemical agonist menthol functions as a gating modifier, shifting activation curves towards physiological membrane potentials. Temperature sensitivity arises from a tenfold difference in the activation energies associated with voltage-dependent opening and closing. In prostate cancer cells, shows strong inward rectification and high calcium selectivity in contrast to its behavior in normal cells which is characterized by outward rectification and poor cationic selectivity. Plays a role in prostate cancer cell migration. Isoform 2 and isoform 3 negatively regulate menthol- and cold-induced channel activity by stabilizing the closed state of the channel.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft. Endoplasmic reticulum membrane.
Target Protein Families
Transient receptor (TC 1.A.4) family, LTrpC subfamily, TRPM8 sub-subfamily
Target Tissue Specificity
Expressed in prostate. Also expressed in prostate tumors and in non-prostatic primary tumors such as colon, lung, breast and skin tumors.
Target Synonyms
Long transient receptor potential channel 6; LTrpC-6; LTrpC6; MGC2849; Short form of the TRPM8 cationic channel ; Transient receptor potential cation channel subfamily M member 8; Transient receptor potential p8; transient receptor potential-p8; Trp p8; Trp-p8; Trpm8; TRPM8_HUMAN; TRPP8
Target Background
Predicted to enable ligand-gated calcium channel activity. Predicted to be involved in calcium ion transmembrane transport and positive regulation of cold-induced thermogenesis. Predicted to act upstream of or within several processes, including cellular calcium ion homeostasis; response to cold; and thermoception. Located in plasma membrane.
Notification