-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1065-1164 of human Hamartin (Q92574) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TSC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1065-1164 of human Hamartin (Q92574) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13947A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSC1 |
| Target Synonyms | LAM; TSC; TSC1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-1080 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1065-1164 of human Hamartin (Q92574). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TTMGEASASIPTTVGSLPSSKSFLGMKARELFRNKSESQCDEDGMTSSLSESLKTELGKDLGVEAKIPLNLDGPHPSPPTPDSVGQLHIMDYNETHHEHS | Uniprot ID | Q92574 |
Uniprot Id
Q92574
Target Species
Human
Target Name
TSC1
Target Full Name
Hamartin
Target Function
In complex with TSC2, inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling. Seems not to be required for TSC2 GAP activity towards RHEB. Implicated as a tumor suppressor. Involved in microtubule-mediated protein transport, but this seems to be due to unregulated mTOR signaling. Acts as a co-chaperone for HSP90AA1 facilitating HSP90AA1 chaperoning of protein clients such as kinases, TSC2 and glucocorticoid receptor NR3C1. Increases ATP binding to HSP90AA1 and inhibits HSP90AA1 ATPase activity. Competes with the activating co-chaperone AHSA1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins. Recruits TSC2 to HSP90AA1 and stabilizes TSC2 by preventing the interaction between TSC2 and ubiquitin ligase HERC1.
Target Involvement
Tuberous sclerosis 1 (TSC1); Lymphangioleiomyomatosis (LAM); Focal cortical dysplasia 2 (FCORD2)
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein.
Target Tissue Specificity
Highly expressed in skeletal muscle, followed by heart, brain, placenta, pancreas, lung, liver and kidney. Also expressed in embryonic kidney cells.
Target Research Area
Cancer
Target Synonyms
Hamartin; kiaa0243; LAM; TSC; Tsc1; Tsc1 gene; TSC1_HUMAN; Tuberous sclerosis 1; Tuberous sclerosis 1 protein; tumor suppressor
Target Background
This gene is a tumor suppressor gene that encodes the growth inhibitory protein hamartin. The encoded protein interacts with and stabilizes the GTPase activating protein tuberin. This hamartin-tuberin complex negatively regulates mammalian target of rapamycin complex 1 (mTORC1) signaling which is a major regulator of anabolic cell growth. This protein also functions as a co-chaperone for Hsp90 that inhibits its ATPase activity. This protein functions as a facilitator of Hsp90-mediated folding of kinase and non-kinase clients, including TSC2 and thereby preventing their ubiquitination and proteasomal degradation. Mutations in this gene have been associated with tuberous sclerosis and lymphangioleiomyomatosis.
Notification