Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSPAN31 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 95-175 of human TSPAN31 (NP_005972.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TSPAN31 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 95-175 of human TSPAN31 (NP_005972.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05770A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSPAN31 |
| Target Synonyms | SAS; TSPAN31 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse brain, Mouse liver, Rat ovary | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 95-175 of human TSPAN31 (NP_005972.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKIL | Uniprot ID | Q12999 |
Uniprot Id
Q12999
Target Species
Human
Target Name
TSPAN31
Target Full Name
Tetraspanin-31
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Tetraspanin (TM4SF) family
Target Synonyms
TSPAN31; SAS; Tetraspanin-31; Tspan-31; Sarcoma-amplified sequence
Target Background
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
