Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TUBGCP5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human TUBGCP5 (NP_443135.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TUBGCP5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human TUBGCP5 (NP_443135.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07114A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TUBGCP5 |
| Target Synonyms | GCP5; TUBGCP5 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TUBGCP5 (NP_443135.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KEIKTDAHYSILSLLLCLSDSPSNSSYVETPRNKEVEKKDDFDWGKYLMEDEEMDIGPYMDTPNWSEESEEENDQQPLSREDSGIQVDRTPLEEQDQNRKL | Uniprot ID | Q96RT8 |
Uniprot Id
Q96RT8
Target Species
Human
Target Name
TUBGCP5
Target Full Name
Gamma-tubulin complex component 5
Target Function
Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
TUBGCP family
Target Tissue Specificity
Widely expressed, with highest levels in heart and skeletal muscle and moderate levels in brain.
Target Synonyms
Gamma tubulin complex component GCP5; Gamma-tubulin complex component 5; GCP 5; GCP-5; GCP5; GCP5_HUMAN; KIAA1899; OTTHUMP00000159254; Tubgcp5; Tubulin gamma complex associated protein 5
Target Background
Enables microtubule binding activity. Involved in microtubule nucleation. Located in centrosome and cytosol. Part of gamma-tubulin large complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
