-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2D2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D2 (NP_003330.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBE2D2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D2 (NP_003330.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01701A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2D2 |
| Target Synonyms | UBC4; PUBC1; UBCH4; UBC4/5; UBCH5B; E2(17)KB2; UBE2D2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, K-562, Mouse brain, Mouse testis, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D2 (NP_003330.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM | Uniprot ID | P62837 |
Uniprot Id
P62837
Target Species
Human
Target Name
UBE2D2
Target Full Name
Ubiquitin-conjugating enzyme E2 D2
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Synonyms
E2(17)KB2; OTTHUMP00000223475; OTTHUMP00000223476; OTTHUMP00000223477; OTTHUMP00000223478; OTTHUMP00000224375; PUBC 1; PUBC1; UB2D2_HUMAN; UBC 4; UBC 4/5; UBC4; UBC4/5; UBC4/5 homolog yeast; UBCH 5B; UBCH5B; UBE2D2; Ubiquitin carrier protein; Ubiquitin carrier protein D2; Ubiquitin conjugating enzyme E2 17 kDa 2; Ubiquitin conjugating enzyme E2 D2; Ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5); Ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog yeast); Ubiquitin conjugating enzyme E2D 2; Ubiquitin protein ligase D2; Ubiquitin-conjugating enzyme E2 D2; Ubiquitin-conjugating enzyme E2(17)KB 2; Ubiquitin-conjugating enzyme E2-17 kDa 2; Ubiquitin-protein ligase D2
Target Background
Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene.
Notification