Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2E1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human UBE2E1 (NP_003332.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBE2E1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human UBE2E1 (NP_003332.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06767A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2E1 |
| Target Synonyms | UBCH6; UBE2E1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29, K-562 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-50 of human UBE2E1 (NP_003332.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAK | Uniprot ID | P51965 |
Uniprot Id
P51965
Target Species
Human
Target Name
UBE2E1
Target Full Name
Ubiquitin-conjugating enzyme E2 E1
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination.
Target Subcellular Location
Nucleus.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Synonyms
UB2E1_HUMAN; UbcH6; Ube2e1; Ubiquitin carrier protein E1; Ubiquitin conjugating enzyme E2E 1 (homologous to yeast UBC4/5); Ubiquitin conjugating enzyme E2E 1; Ubiquitin-conjugating enzyme E2 E1; ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast); Ubiquitin-protein ligase E1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
