-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-250 of human UBE4B (NP_006039.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBE4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-250 of human UBE4B (NP_006039.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10511A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE4B |
| Target Synonyms | E4; UFD2; HDNB1; UBOX3; UFD2A; UBE4B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse testis, OVCAR3, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-250 of human UBE4B (NP_006039.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFLSSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPDRNLLLNTGSN | Uniprot ID | O95155 |
Uniprot Id
O95155
Target Species
Human
Target Name
UBE4B
Target Full Name
Ubiquitin conjugation factor E4 B
Target Function
Ubiquitin-protein ligase that probably functions as an E3 ligase in conjunction with specific E1 and E2 ligases. May also function as an E4 ligase mediating the assembly of polyubiquitin chains on substrates ubiquitinated by another E3 ubiquitin ligase. May regulate myosin assembly in striated muscles together with STUB1 and VCP/p97 by targeting myosin chaperone UNC45B for proteasomal degradation.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Ubiquitin conjugation factor E4 family
Target Tissue Specificity
Expressed in differentiated myotubes (at protein level). Highest expression in ovary, testis, heart and skeletal muscle. Expression is low in colon, thymus and peripheral blood leukocytes. Almost undetectable in lung and spleen.
Target Synonyms
4930551I19Rik; 4933406G05Rik; AU014668; D4Bwg0973e; E4; HDNB1; Homozygously deleted in neuroblastoma 1; KIAA0684; mKIAA0684; RP23 173D8.1; Ube4b; UBE4B_HUMAN; Ubiquitin conjugation factor E4 B; Ubiquitin fusion degradation protein 2; UBOX3; UFD2; UFD2a; Ufd2p
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification