-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UGT1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of humanUGT1A1 (NP_000454.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against UGT1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of humanUGT1A1 (NP_000454.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-15074A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UGT1A1 |
| Target Synonyms | GNT1; UGT1; UDPGT; UGT1A; HUG-BR1; BILIQTL1; UDPGT 1-1; UGT1A1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of humanUGT1A1 (NP_000454.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSH | Uniprot ID | P22309 |
Uniprot Id
P22309
Target Species
Human
Target Name
UGT1A1
Target Full Name
UDP-glucuronosyltransferase 1A1
Target Function
UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol. Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates. Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan.; Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
Target Involvement
Gilbert syndrome (GILBS); Transient familial neonatal hyperbilirubinemia (HBLRTFN); Crigler-Najjar syndrome 1 (CN1); Crigler-Najjar syndrome 2 (CN2)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cytoplasm, perinuclear region.
Target Protein Families
UDP-glycosyltransferase family
Target Tissue Specificity
[Isoform 1]: Expressed in liver, colon and small intestine. Not expressed in kidney, esophagus and skin.; [Isoform 2]: Expressed in liver, colon, small intestine and kidney. Not expressed in esophagus and skin.
Target Research Area
Metabolism
Target Synonyms
BILIQTL1; Bilirubin specific UDPGT isozyme 1; bilirubin UDP glucuronosyltransferase 1 1; bilirubin UDP glucuronosyltransferase isozyme 1; Bilirubin-specific UDPGT isozyme 1; EC 2.4.1.17; GNT1; HUG BR1; HUG-BR1; HUGBR1; PHENOL/BILIRUBIN UDP GLUCURONOSYLTRANSFERASE; UD11_HUMAN; UDP glucuronosyltransferase 1 1 [Precursor]; UDP glucuronosyltransferase 1 family polypeptide A1; UDP glucuronosyltransferase 1A1; UDP GLYCOSYLTRANSFERASE 1; UDP-glucuronosyltransferase 1-1; UDP-glucuronosyltransferase 1-A; UDP-glucuronosyltransferase 1A1; UDPGT; UDPGT 1-1; UGT 1A; UGT-1A; UGT1; UGT1 01; UGT1*1; UGT1-01; UGT1.1; UGT1A; Ugt1a1; URIDINE DIPHOSPHATE GLUCURONOSYLTRANSFERASE, BILIRUBIN/PHENOL; URIDINE DIPHOSPHATE GLYCOSYLTRANSFERASE 1; URIDINE DIPHOSPHATE GLYCOSYLTRANSFERASE 1 FAMILY, POLYPEPTIDE A1
Target Background
This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids. Mutations in this gene result in Crigler-Najjar syndromes types I and II and in Gilbert syndrome.
Notification