Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UPK3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-200 of human UPK3B (NP_085047.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UPK3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-200 of human UPK3B (NP_085047.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07974A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UPK3B |
| Target Synonyms | P35; UP3B; UPIIIB; UPK3B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-200 of human UPK3B (NP_085047.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLGEAAPGTPTPVSVAHLLSPVATELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVAFSNASRGFQNPETLADIPASPQLLTDGHYMTLPLSPDQLPCGDPMAGSGGAPVLRVGHDHGCHQQPFCNA | Uniprot ID | Q9BT76 |
Uniprot Id
Q9BT76
Target Species
Human
Target Name
UPK3B
Target Full Name
Uroplakin-3b
Target Function
Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Uroplakin-3 family
Target Synonyms
FLJ32198; MGC10902; p35; UP3b; UPIIIb; UPK3B; UPK3B_HUMAN; uroplakin 3B; Uroplakin IIIb; Uroplakin-3b
Target Background
UPK3B is a minor component of the apical plaques of mammalian urothelium that binds and dimerizes with uroplakin-1b (UPK1B; MIM 602380), one of the major conserved urothelium membrane proteins. The other major conserved integral membrane proteins of urothelial plaques are UPK1A (MIM 611557), UPK2 (MIM 611558), and UPK3A (MIM 611559) (Deng et al., 2002 [PubMed 12446744]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
