-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UQCR10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UQCR10 (NP_037519.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against UQCR10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UQCR10 (NP_037519.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-06318A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UQCR10 |
| Target Synonyms | QCR9; UCRC; HSPC051; HSPC119; HSPC151; UCCR7.2; UQCR10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat heart, 22Rv1, NCI-H460 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UQCR10 (NP_037519.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK | Uniprot ID | Q9UDW1 |
Uniprot Id
Q9UDW1
Target Species
Human
Target Name
UQCR10
Target Full Name
Cytochrome b-c1 complex subunit 9
Target Function
Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Protein Families
UQCR10/QCR9 family
Target Research Area
Tags & Cell Markers
Target Synonyms
UQCR10; UCRC; HSPC119; Cytochrome b-c1 complex subunit 9; Complex III subunit 9; Complex III subunit X; Cytochrome c1 non-heme 7 kDa protein; Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
Target Background
UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).
Notification