-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UQCRFS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 175-274 of human UQCRFS1 (P47985) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against UQCRFS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 175-274 of human UQCRFS1 (P47985) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14039A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UQCRFS1 |
| Target Synonyms | RIP1; RIS1; RISP; UQCR5; MC3DN10; UQCRFS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, A-549, Mouse liver, Raji, Rat testis, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 175-274 of human UQCRFS1 (P47985). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG | Uniprot ID | P47985 |
Uniprot Id
P47985
Target Species
Human
Target Name
UQCRFS1
Target Full Name
Cytochrome b-c1 complex subunit Rieske, mitochondrial
Target Function
Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c. The Rieske protein is a catalytic core subunit containing a Component of the ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII). UQCRFS1 undergoes proteolytic processing once it is incorporated in the complex III dimer. One of the fragments, called subunit 9, corresponds to its mitochondrial targeting sequence (MTS). The proteolytic processing is necessary for the correct insertion of UQCRFS1 in the complex III dimer, but the persistence of UQCRFS1-derived fragments may prevent newly imported UQCRFS1 to be processed and assembled into complex III and is detrimental for the complex III structure and function.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Research Area
Transport
Target Synonyms
Complex III subunit 5; Complex III subunit IX; Cytochrome b c1 complex subunit Rieske mitochondrial; Cytochrome b-c1 complex subunit 11; Cytochrome b-c1 complex subunit 5; Cytochrome b6f complex iron sulfur subunit, chloroplastic; petC; PGR1; Plastohydroquinone:plastocyanin oxidoreductase iron sulfur protein; Proton gradient regulation protein 1; Rieske iron sulfur protein; Rieske iron-sulfur protein; RIP1; RIS1; RISP; Ubiquinol cytochrome C reductase rieske iron sulphur; Ubiquinol cytochrome c reductase Rieske iron-sulfur polypeptide 1; Ubiquinol-cytochrome c reductase 8 kDa protein; Ubiquinol-cytochrome c reductase iron-sulfur subunit; UCRI_HUMAN; UQCR5; UQCRFS1
Target Background
Predicted to enable oxidoreductase activity. Involved in mitochondrial respiratory chain complex III assembly and respiratory electron transport chain. Located in mitochondrion. Part of mitochondrial respiratory chain complex III and mitochondrial respiratory chain complex IV. Implicated in mitochondrial complex III deficiency.
Notification