-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human USP19 (NP_001186089.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against USP19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human USP19 (NP_001186089.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00939A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP19 |
| Target Synonyms | ZMYND9; USP19 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human USP19 (NP_001186089.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGGASATGPRRGPPGLEDTTSKKKQKDRANQESKDGDPRKETGSRYVAQAGLEPLASGDPSASASHAAGITGSRHRTRLFFPSSSGSASTPQEEQTKEGACEDPHDLLATPTPELLLDWRQSAEEVIVKLRVGVGPLQLEDVDAAFTDTDCVVRFAGGQQWGGVFYAEIKSSCAKVQTRKGSLLHLTLPKKVPMLTWPS | Uniprot ID | O94966 |
Uniprot Id
O94966
Target Species
Human
Target Name
USP19
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 19
Target Function
Deubiquitinating enzyme that regulates the degradation of various proteins. Deubiquitinates and prevents proteasomal degradation of RNF123 which in turn stimulates CDKN1B ubiquitin-dependent degradation thereby playing a role in cell proliferation. Involved in decreased protein synthesis in atrophying skeletal muscle. Modulates transcription of major myofibrillar proteins. Also involved in turnover of endoplasmic-reticulum-associated degradation (ERAD) substrates. Regulates the stability of BIRC2/c-IAP1 and BIRC3/c-IAP2 by preventing their ubiquitination. Required for cells to mount an appropriate response to hypoxia and rescues HIF1A from degradation in a non-catalytic manner. Plays an important role in 17 beta-estradiol (E2)-inhibited myogenesis. Decreases the levels of ubiquitinated proteins during skeletal muscle formation and acts to repress myogenesis. Exhibits a preference towards 'Lys-63'-linked ubiquitin chains.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
Peptidase C19 family
Target Synonyms
8430421I07Rik; AI047774; Deubiquitinating enzyme 19; Ubiquitin carboxyl terminal hydrolase 19; Ubiquitin carboxyl-terminal hydrolase 19; Ubiquitin specific peptidase 19; Ubiquitin specific processing protease 19; Ubiquitin specific protease 19; Ubiquitin thioesterase 19; Ubiquitin thiolesterase 19; Ubiquitin-specific-processing protease 19; UBP19_HUMAN; Usp19; Zinc finger MYND domain containing protein 9; Zinc finger MYND domain-containing protein 9; ZMYND9
Target Background
Protein ubiquitination controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. This dynamic process, involving ubiquitin conjugating enzymes and deubiquitinating enzymes, adds and removes ubiquitin. Deubiquitinating enzymes are cysteine proteases that specifically cleave ubiquitin from ubiquitin-conjugated protein substrates. This protein is a ubiquitin protein ligase and plays a role in muscle wasting. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification