Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP47 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1128-1287 of human USP47 (NP_060414.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against USP47 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1128-1287 of human USP47 (NP_060414.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10092A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP47 |
| Target Synonyms | TRFP; USP47 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse brain, SGC-7901 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1128-1287 of human USP47 (NP_060414.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VEKMKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD | Uniprot ID | Q96K76 |
Uniprot Id
Q96K76
Target Species
Human
Target Name
USP47
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 47
Target Function
Ubiquitin-specific protease that specifically deubiquitinates monoubiquitinated DNA polymerase beta (POLB), stabilizing POLB thereby playing a role in base-excision repair (BER). Acts as a regulator of cell growth and genome integrity. May also indirectly regulate CDC25A expression at a transcriptional level.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Peptidase C19 family
Target Tissue Specificity
Expressed in skeletal muscle, heart and testis.
Target Synonyms
Deubiquitinating enzyme 47; TFRP; Trf TATA binding protein related factor proximal homolog; Trf TATA binding protein related factor proximal homolog Drosophila; Ubiquitin carboxyl-terminal hydrolase 47; Ubiquitin specific peptidase 47; Ubiquitin specific processing protease 47; Ubiquitin specific protease 47; Ubiquitin thioesterase 47; Ubiquitin thiolesterase 47; Ubiquitin-specific-processing protease 47; UBP47_HUMAN; USP47
Target Background
Enables WD40-repeat domain binding activity and thiol-dependent deubiquitinase. Involved in several processes, including monoubiquitinated protein deubiquitination; negative regulation of G2/M transition of mitotic cell cycle; and negative regulation of nitrogen compound metabolic process. Located in cytoplasm. Part of SCF ubiquitin ligase complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
