-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VEGFR3/FLT4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1230-1329 of human VEGFR3/FLT4 (NP_891555.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VEGFR3/FLT4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1230-1329 of human VEGFR3/FLT4 (NP_891555.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02312A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VEGFR3/FLT4 |
| Target Synonyms | PCL; CHTD7; FLT-4; FLT41; LMPH1A; LMPHM1; VEGFR3; VEGFR-3; VEGFR3/FLT4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, LO2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1230-1329 of human VEGFR3/FLT4 (NP_891555.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRRRPERGARGG | Uniprot ID | P35916 |
Uniprot Id
P35916
Target Species
Human
Target Name
FLT4
Target Full Name
Vascular endothelial growth factor receptor 3
Target Function
Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFC and VEGFD, and plays an essential role in adult lymphangiogenesis and in the development of the vascular network and the cardiovascular system during embryonic development. Promotes proliferation, survival and migration of endothelial cells, and regulates angiogenic sprouting. Signaling by activated FLT4 leads to enhanced production of VEGFC, and to a lesser degree VEGFA, thereby creating a positive feedback loop that enhances FLT4 signaling. Modulates KDR signaling by forming heterodimers. The secreted isoform 3 may function as a decoy receptor for VEGFC and/or VEGFD and play an important role as a negative regulator of VEGFC-mediated lymphangiogenesis and angiogenesis. Binding of vascular growth factors to isoform 1 or isoform 2 leads to the activation of several signaling cascades; isoform 2 seems to be less efficient in signal transduction, because it has a truncated C-terminus and therefore lacks several phosphorylation sites. Mediates activation of the MAPK1/ERK2, MAPK3/ERK1 signaling pathway, of MAPK8 and the JUN signaling pathway, and of the AKT1 signaling pathway. Phosphorylates SHC1. Mediates phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Promotes phosphorylation of MAPK8 at 'Thr-183' and 'Tyr-185', and of AKT1 at 'Ser-473'.
Target Involvement
Lymphedema, hereditary, 1A (LMPH1A); Hemangioma, capillary infantile (HCI)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm. Nucleus.; [Isoform 1]: Cell membrane; Single-pass type I membrane protein. Note=Ligand-mediated autophosphorylation leads to rapid internalization.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted. Cytoplasm.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily
Target Tissue Specificity
Detected in endothelial cells (at protein level). Widely expressed. Detected in fetal spleen, lung and brain. Detected in adult liver, muscle, thymus, placenta, lung, testis, ovary, prostate, heart, and kidney.
Target Research Area
Signal Transduction
Target Synonyms
EC 2.7.10.1; flt 4; FLT-4; FLT4; FLT41; Fms related tyrosine kinase 4; Fms-like tyrosine kinase 4; LMPH1A; PCL; Soluble VEGFR3 variant 1; Soluble VEGFR3 variant 2; Soluble VEGFR3 variant 3; Tyrosine protein kinase receptor FLT4; Tyrosine-protein kinase receptor FLT4; Vascular endothelial growth factor receptor 3; Vascular endothelial growth factor receptor 3 precursor; VEGF R3; VEGFR 3; VEGFR-3; VEGFR3; VGFR3_HUMAN
Target Background
This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA.
Notification