-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VPS36 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-220 of human VPS36 (NP_057159.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against VPS36 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-220 of human VPS36 (NP_057159.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05238A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VPS36 |
| Target Synonyms | EAP45; C13orf9; CGI-145; VPS36 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-220 of human VPS36 (NP_057159.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSY | Uniprot ID | Q86VN1 |
Uniprot Id
Q86VN1
Target Species
Human
Target Name
VPS36
Target Full Name
Vacuolar protein-sorting-associated protein 36
Target Function
Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by ESCRT complexes. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. Binds phosphoinosides such as PtdIns(3,4,5)P3.
Target Subcellular Location
Cytoplasm. Endosome. Late endosome. Membrane. Nucleus.
Target Protein Families
VPS36 family
Target Synonyms
C13orf9; CGI 145; EAP45; ELL associated protein of 45 kDa; ELL-associated protein of 45 kDa; ESCRT-II complex subunit VPS36; Vacuolar protein sorting associated protein 36; Vacuolar protein-sorting-associated protein 36; Vps36; VPS36_HUMAN
Target Background
This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A similar protein complex in rat is associated with RNA polymerase elongation factor II.
Notification