Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VPS37B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-170 of human VPS37B (NP_078943.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VPS37B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-170 of human VPS37B (NP_078943.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07084A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VPS37B |
| Target Synonyms | VPS37B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-170 of human VPS37B (NP_078943.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLP | Uniprot ID | Q9H9H4 |
Uniprot Id
Q9H9H4
Target Species
Human
Target Name
VPS37B
Target Full Name
Vacuolar protein sorting-associated protein 37B
Target Function
Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation.
Target Subcellular Location
Late endosome membrane; Peripheral membrane protein. Note=Recruited to the endosomal membrane in a VPS4A-dependent fashion.
Target Protein Families
VPS37 family
Target Tissue Specificity
Widely expressed. Expressed in macrophages and lymphocytes.
Target Synonyms
VPS37B; Vacuolar protein sorting-associated protein 37B; hVps37B; ESCRT-I complex subunit VPS37B
Target Background
Enables calcium-dependent protein binding activity. Involved in positive regulation of viral budding via host ESCRT complex. Located in endosome membrane; midbody; and plasma membrane. Part of ESCRT I complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
