Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-140 of human WBP2 (NP_036610.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-140 of human WBP2 (NP_036610.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06693A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WBP2 |
| Target Synonyms | WBP-2; GRAMD6; DFNB107; WBP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, A-375, Rat spleen, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 15-140 of human WBP2 (NP_036610.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPS | Uniprot ID | Q969T9 |
Uniprot Id
Q969T9
Target Species
Human
Target Name
WBP2
Target Full Name
WW domain-binding protein 2
Target Function
Acts as transcriptional coactivator of estrogen and progesterone receptors (ESR1 and PGR) upon hormone activation. In presence of estrogen, binds to ESR1-responsive promoters. Required for YAP1 coactivation function on PGR activity. Synergizes with WBP2 in enhancing PGR activity. Modulates expression of post-synaptic scaffolding proteins via regulation of ESR1, ESR2 and PGR.
Target Involvement
Deafness, autosomal recessive, 107 (DFNB107)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
MGC18269; WBP 2; WBP-2; Wbp2; WBP2_HUMAN; WW domain binding protein 2; WW domain-binding protein 2
Target Background
The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein that is a transcriptional coactivator of estrogen receptor alpha and progesterone receptor. Defects in this gene have been associated with hearing impairment.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
