Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WDFY2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human WDFY2 (NP_443182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WDFY2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human WDFY2 (NP_443182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01655A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WDFY2 |
| Target Synonyms | PROF; WDF2; ZFYVE22; WDFY2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human WDFY2 (NP_443182.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTG | Uniprot ID | Q96P53 |
Uniprot Id
Q96P53
Target Species
Human
Target Name
WDFY2
Target Full Name
WD repeat and FYVE domain-containing protein 2
Target Function
Acts in an adapter protein-like fashion to mediate the interaction between the kinase PRKCZ and its substrate VAMP2 and increases the PRKCZ-dependent phosphorylation of VAMP2. Positively regulates adipocyte differentiation, by facilitating the phosphorylation and thus inactivation of the anti-adipogenetic transcription factor FOXO1 by the kinase AKT1. Plays a role in endosomal control of AKT2 signaling; required for insulin-stimulated AKT2 phosphorylation and glucose uptake and insulin-stimulated phosphorylation of AKT2 substrates. Participates in transferrin receptor endocytosis.
Target Subcellular Location
Endosome. Early endosome. Cytoplasm.
Target Synonyms
PROF; Propeller-FYVE protein; RP11 147H23.1; WD repeat and FYVE domain containing 2; WD repeat and FYVE domain-containing protein 2; WD40 and FYVE domain containing 2; WD40- and FYVE domain-containing protein 2; WDF2; Wdfy2; WDFY2_HUMAN; ZFYVE22; Zinc finger FYVE domain-containing protein 22
Target Background
This gene encodes a protein that contains two WD domains and an FYVE zinc finger region. The function of this gene is unknown. An alternatively spliced transcript variant of this gene may exist.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
