-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WEE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WEE1 (NP_003381.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against WEE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WEE1 (NP_003381.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-14851A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WEE1 |
| Target Synonyms | WEE1A; WEE1hu; WEE1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WEE1 (NP_003381.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDSPLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACP | Uniprot ID | P30291 |
Uniprot Id
P30291
Target Species
Human
Target Name
WEE1
Target Full Name
Wee1-like protein kinase
Target Function
Acts as a negative regulator of entry into mitosis (G2 to M transition) by protecting the nucleus from cytoplasmically activated cyclin B1-complexed CDK1 before the onset of mitosis by mediating phosphorylation of CDK1 on 'Tyr-15'. Specifically phosphorylates and inactivates cyclin B1-complexed CDK1 reaching a maximum during G2 phase and a minimum as cells enter M phase. Phosphorylation of cyclin B1-CDK1 occurs exclusively on 'Tyr-15' and phosphorylation of monomeric CDK1 does not occur. Its activity increases during S and G2 phases and decreases at M phase when it is hyperphosphorylated. A correlated decrease in protein level occurs at M/G1 phase, probably due to its degradation.
Target Subcellular Location
Nucleus.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, WEE1 subfamily
Target Research Area
Cell Biology
Target Synonyms
DKFZp686I18166; EC 2.7.10.2; FLJ16446; MGC105683; OTTHUMP00000231338; OTTHUMP00000231339; Wee 1; WEE 1 homolog 1 (S. pombe); WEE1; WEE1 homolog (S. pombe); Wee1 homolog; WEE1 homolog S. pombe; Wee1 like protein kinase; Wee1 tyrosine kinase; Wee1+ homolog; Wee1+ S. pombe homolog; WEE1, S. pombe, homolog of; WEE1, somatic; Wee1-like protein kinase; WEE1_HUMAN; WEE1A; Wee1A kinase; WEE1hu
Target Background
This gene encodes a nuclear protein, which is a tyrosine kinase belonging to the Ser/Thr family of protein kinases. This protein catalyzes the inhibitory tyrosine phosphorylation of CDC2/cyclin B kinase, and appears to coordinate the transition between DNA replication and mitosis by protecting the nucleus from cytoplasmically activated CDC2 kinase.
Notification