Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WIF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 280-379 of human WIF1 (Q9Y5W5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WIF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 280-379 of human WIF1 (Q9Y5W5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13955A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WIF1 |
| Target Synonyms | WIF-1; WIF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung, Mouse stomach, Rat lung, Rat stomach | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 280-379 of human WIF1 (Q9Y5W5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW | Uniprot ID | Q9Y5W5 |
Uniprot Id
Q9Y5W5
Target Species
Human
Target Name
WIF1
Target Full Name
Wnt inhibitory factor 1
Target Function
Binds to WNT proteins and inhibits their activities. May be involved in mesoderm segmentation.
Target Subcellular Location
Secreted.
Target Synonyms
WIF-1; wif1; WIF1_HUMAN; Wnt inhibitory factor 1
Target Background
The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation. This gene functions as a tumor suppressor gene, and has been found to be epigenetically silenced in various cancers.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
