Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WRB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human WRB (NP_004618.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against WRB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human WRB (NP_004618.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02751A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WRB |
| Target Synonyms | WRB; CHD5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse skin, Mouse testis, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human WRB (NP_004618.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKI | Uniprot ID | O00258 |
Uniprot Id
O00258
Target Species
Human
Target Name
GET1
Target Full Name
Guided entry of tail-anchored proteins factor 1
Target Function
Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). Together with CAMLG/GET2, acts as a membrane receptor for soluble GET3/TRC40, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. Required to ensure correct topology and ER insertion of CAMLG.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
WRB/GET1 family
Target Synonyms
GET1; CHD5; WRB; Guided entry of tail-anchored proteins factor 1; Congenital heart disease 5 protein; Tail-anchored protein insertion receptor WRB; Tryptophan-rich basic protein
Target Background
This gene is located in the candidate region for congenital heart disease (CHD) in Down syndrome (DS). It encodes a basic protein that functions as a receptor that promotes insertion of tail-anchored proteins in the endoplasmic reticulum membrane. This gene is located at a maternally-methylated differentially methylated region (DMR); however, its transcription may be biallelic, not imprinted. Alternative splicing results in different transcript variants. A pseudogene has been defined on chromosome 4.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
