Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against XAB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 761-855 of human XAB2 (NP_064581.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against XAB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 761-855 of human XAB2 (NP_064581.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06033A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | XAB2 |
| Target Synonyms | HCNP; HCRN; SYF1; NTC90; XAB2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, LO2, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 761-855 of human XAB2 (NP_064581.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED | Uniprot ID | Q9HCS7 |
Uniprot Id
Q9HCS7
Target Species
Human
Target Name
XAB2
Target Full Name
Pre-mRNA-splicing factor SYF1
Target Function
Involved in pre-mRNA splicing as component of the spliceosome. Involved in transcription-coupled repair (TCR), transcription and pre-mRNA splicing.
Target Subcellular Location
Nucleus.
Target Protein Families
Crooked-neck family
Target Synonyms
0610041O14Rik; adapter protein ATH 55; Adapter protein ATH-55; Ath55; AV025587; Crn related protein kim1; crn-related protein kim1; DKFZp762C1015; HCNP; HCNP protein; HCRN; KIAA1177; NTC90; PP3898; Pre-mRNA-splicing factor SYF1; Protein HCNP; RNA splicing factor; SYF1; SYF1 homolog; SYF1 homolog, RNA splicing factor; SYF1 pre mRNA splicing factor; SYF1_HUMAN; Xab2; XPA binding protein 2; XPA-binding protein 2
Target Background
Involved in mRNA splicing, via spliceosome; transcription, DNA-templated; and transcription-coupled nucleotide-excision repair. Located in nucleoplasm. Part of U2-type catalytic step 2 spliceosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
