Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against YY2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY2 (NP_996806.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against YY2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY2 (NP_996806.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08714A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | YY2 |
| Target Synonyms | ZNF631; YY2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY2 (NP_996806.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEGQAENPPDYSEYLKGKKLPPGGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRR | Uniprot ID | O15391 |
Uniprot Id
O15391
Target Species
Human
Target Name
YY2
Target Full Name
Transcription factor YY2
Target Function
Functions as a multifunctional transcription factor that may exhibit positive and negative control on a large number of genes. May antagonize YY1 and function in development and differentiation.
Target Subcellular Location
Nucleus.
Target Protein Families
YY transcription factor family
Target Tissue Specificity
Expressed in kidney, liver, spleen and testis but not in colon.
Target Synonyms
Transcription factor yin yang 2; Transcription factor YY2; TYY2_HUMAN; Yin and yang 2; YY-2; Yy2; YY2 transcription factor; Zinc finger protein 631; ZNF631
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
