Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZFAND5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human ZFAND5 (NP_001095890.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZFAND5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human ZFAND5 (NP_001095890.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03495A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZFAND5 |
| Target Synonyms | ZA20D2; ZNF216; ZFAND5A; ZFAND5 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human ZFAND5 (NP_001095890.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPK | Uniprot ID | O76080 |
Uniprot Id
O76080
Target Species
Human
Target Name
ZFAND5
Target Full Name
AN1-type zinc finger protein 5
Target Function
Involved in protein degradation via the ubiquitin-proteasome system. May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of NF-kappa-B activation and apoptosis. Inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apoptosis. Is a potent inhibitory factor for osteoclast differentiation
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Highly expressed in skeletal muscle. Expressed in fetal cochlea. Also expressed in infant brain, fetal heart, pancreatic islet, melanocyte, pineal gland, placenta, corneal stroma, and parathyroid tumor. Weakly expressed or undetectable in adult brain, hea
Target Synonyms
AN1-type zinc finger protein 5; ZA20D2; ZFAN5_HUMAN; Zfand5; ZFAND5A; zinc finger A20 domain containing 2; Zinc finger A20 domain containing protein 2; Zinc finger A20 domain-containing protein 2; zinc finger AN1 type domain 5; Zinc finger protein 216; ZNF216
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
