-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZFPM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 982-1151 of human ZFPM2 (NP_036214.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZFPM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 982-1151 of human ZFPM2 (NP_036214.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00888A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZFPM2 |
| Target Synonyms | DIH3; FOG2; SRXY9; ZNF89B; hFOG-2; ZC2HC11B; ZFPM2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-1080, K-562, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 982-1151 of human ZFPM2 (NP_036214.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQASSNGCAALKKDSLPLLPKNRGMVIVNGGLKQDERPAANPQQENISQNPQHEDDHKSPSWISENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKYCRLCDIQFNNLSNFITHKKFYCSSHAAEHVK | Uniprot ID | Q8WW38 |
Uniprot Id
Q8WW38
Target Species
Human
Target Name
ZFPM2
Target Full Name
Zinc finger protein ZFPM2
Target Function
Transcription regulator that plays a central role in heart morphogenesis and development of coronary vessels from epicardium, by regulating genes that are essential during cardiogenesis. Essential cofactor that acts via the formation of a heterodimer with transcription factors of the GATA family GATA4, GATA5 and GATA6. Such heterodimer can both activate or repress transcriptional activity, depending on the cell and promoter context. Also required in gonadal differentiation, possibly be regulating expression of SRY. Probably acts a corepressor of NR2F2.
Target Involvement
Tetralogy of Fallot (TOF); Diaphragmatic hernia 3 (DIH3); 46,XY sex reversal 9 (SRXY9); Conotruncal heart malformations (CTHM)
Target Subcellular Location
Nucleus.
Target Protein Families
FOG (Friend of GATA) family
Target Tissue Specificity
Widely expressed at low level.
Target Synonyms
FOG-2; FOG2_HUMAN; Friend of GATA 2; Friend of GATA protein 2; Friend of GATA2; hFOG-2; ZFPM2; Zinc finger protein 89B; Zinc finger protein M2; Zinc finger protein multitype 2; Zinc finger protein ZFPM2
Target Background
The zinc finger protein encoded by this gene is a widely expressed member of the FOG family of transcription factors. The family members modulate the activity of GATA family proteins, which are important regulators of hematopoiesis and cardiogenesis in mammals. It has been demonstrated that the protein can both activate and down-regulate expression of GATA-target genes, suggesting different modulation in different promoter contexts. A related mRNA suggests an alternatively spliced product but this information is not yet fully supported by the sequence.
Notification