Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF141 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 405-474 of human ZNF141 (NP_003432.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against ZNF141 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 405-474 of human ZNF141 (NP_003432.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of ZNF141 in paraffin-embedded mouse lung using ZNF141 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-05448A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF141 |
| Target Synonyms | D4S90; pHZ-44; ZNF141 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 405-474 of human ZNF141 (NP_003432.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRSTDRSQHKKIHSADKPYKCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIHT | Uniprot ID | Q15928 |
Uniprot Id
Q15928
Target Species
Human
Target Name
ZNF141
Target Full Name
Zinc finger protein 141
Target Function
May be involved in transcriptional regulation as a repressor. Plays a role in limb development.
Target Involvement
Polydactyly, postaxial A6 (PAPA6)
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Ubiquitously low expression.
Target Synonyms
ZNF141; D4S90; Zinc finger protein 141
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
