Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF331 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human ZNF331 (NP_061025.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF331 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human ZNF331 (NP_061025.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using ZNF331 Rabbit pAb at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
| Cat.No | ADA-05032A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF331 |
| Target Synonyms | RITA; ZNF361; ZNF463; ZNF331 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293F, PC-3, Rat testis, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human ZNF331 (NP_061025.5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENS | Uniprot ID | Q9NQX6 |
Uniprot Id
Q9NQX6
Target Species
Human
Target Name
ZNF331
Target Full Name
Zinc finger protein 331
Target Function
May be involved in transcriptional regulation. May play a role in spermatogenesis.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Testis specific.
Target Synonyms
C2H2 like zinc finger protein; C2H2 like zinc finger protein rearranged in thyroid adenomas; C2H2-like zinc finger protein rearranged in thyroid adenomas; DKFZp686L0787; KRAB zinc finger protein; OTTHUMP00000223038; OTTHUMP00000223039; OTTHUMP00000223040; OTTHUMP00000223041; OTTHUMP00000223042; OTTHUMP00000223043; OTTHUMP00000223045; OTTHUMP00000223046; OTTHUMP00000223047; OTTHUMP00000223048; OTTHUMP00000223052; OTTHUMP00000223053; OTTHUMP00000223054; RITA; Zinc finger protein 331; Zinc finger protein 361; Zinc finger protein 463; ZN331_HUMAN; ZNF331; ZNF361; ZNF463
Target Background
This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) and shows allele-specific expression in placenta. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding the same protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
