Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF426 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-270 of human ZNF426 (NP_077011.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF426 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-270 of human ZNF426 (NP_077011.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse liver, using ZNF426 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-07081A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF426 |
| Target Synonyms | K-RBP; ZNF426 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 150-270 of human ZNF426 (NP_077011.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QCGEVFSEHSCLKTHVRTQSTGNTHDCNQYGKDFLTLCEKTSTGEKLSEFNQSEKIFSLTPNIVYQRTSTQEKSFECSHCGKSFINESYLQAHMRTHNGEKLYEWRNYGPGFIDSTSLSVL | Uniprot ID | Q9BUY5 |
Uniprot Id
Q9BUY5
Target Species
Human
Target Name
ZNF426
Target Full Name
Zinc finger protein 426
Target Function
May be involved in transcriptional regulation.
Target Subcellular Location
Nucleus.
Target Synonyms
ZNF426; Zinc finger protein 426
Target Background
Kaposi's sarcoma-associated herpesvirus (KSHV) can be reactivated from latency by the viral protein RTA. The protein encoded by this gene is a zinc finger transcriptional repressor that interacts with RTA to modulate RTA-mediated reactivation of KSHV. While the encoded protein can repress KSHV reactivation, RTA can induce degradation of this protein through the ubiquitin-proteasome pathway to overcome the repression. Several transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
