Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF641 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human ZNF641 (NP_689533.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF641 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human ZNF641 (NP_689533.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05639A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF641 |
| Target Synonyms | ZNF641 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, 293T, A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human ZNF641 (NP_689533.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERDILRVTYTGDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEHDESWDSMPSSSRGMLLGPPFLQEDSFSNLLCSTEMDSL | Uniprot ID | Q96N77 |
Uniprot Id
Q96N77
Target Species
Human
Target Name
ZNF641
Target Full Name
Zinc finger protein 641
Target Function
Transcriptional activator. Activates transcriptional activities of SRE and AP-1.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Highly expressed in skeletal muscle, moderate expression in heart, liver, and pancreas, lower expression in placenta, no expression seen in brain, lung, and kidney.
Target Synonyms
ZNF641; Zinc finger protein 641
Target Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Located in cytosol and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
