Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNF652 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human ZNF652 (NP_055712.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNF652 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human ZNF652 (NP_055712.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11018A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNF652 |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Rat brain, BxPC-3, Jurkat, Mouse liver |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human ZNF652 (NP_055712.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSHTASSCQELVENCAVHVAGMAQEDSRRGQVPSSFYHGANQELDLSTKVYKRESGSPYSVLVDTKMSKPHLHE | Uniprot ID | Q9Y2D9 |
Uniprot Id
Q9Y2D9
Target Species
Human
Target Name
ZNF652
Target Full Name
Zinc finger protein 652
Target Function
Functions as a transcriptional repressor.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Widely expressed with higher expression in breast, prostate, vulva and pancreas.
Target Synonyms
DKFZp781E2122; KIAA0924; OTTHUMP00000220047; Zinc finger protein 652; ZN652_HUMAN; ZNF652
Target Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
