-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZNRF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ZNRF1 (NP_115644.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZNRF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ZNRF1 (NP_115644.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04746A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZNRF1 |
| Target Synonyms | NIN283; ZNRF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse lung, Mouse thymus, Rat thymus, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ZNRF1 (NP_115644.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRL | Uniprot ID | Q8ND25 |
Uniprot Id
Q8ND25
Target Species
Human
Target Name
ZNRF1
Target Full Name
E3 ubiquitin-protein ligase ZNRF1
Target Function
E3 ubiquitin-protein ligase that mediates the ubiquitination of AKT1 and GLUL, thereby playing a role in neuron cells differentiation. Plays a role in the establishment and maintenance of neuronal transmission and plasticity. Regulates Schwann cells differentiation by mediating ubiquitination of GLUL. Promotes neurodegeneration by mediating 'Lys-48'-linked polyubiquitination and subsequent degradation of AKT1 in axons: degradation of AKT1 prevents AKT1-mediated phosphorylation of GSK3B, leading to GSK3B activation and phosphorylation of DPYSL2/CRMP2 followed by destabilization of microtubule assembly in axons
Target Subcellular Location
Endosome. Lysosome. Membrane; Peripheral membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Peripheral membrane protein. Note=Associated with synaptic vesicle membranes in neurons.
Target Tissue Specificity
Expressed primarily in the nervous system, with expression higher in developing brain relative to adult. Expressed at low levels in testis and thymus.
Target Synonyms
B830022L21Rik; DKFZp434E229; E3 ubiquitin protein ligase ZNRF1; E3 ubiquitin-protein ligase ZNRF1; EC 6.3.2.-; FLJ14846; MGC101991; MGC15430; Nerve injury gene 283; Nerve injury induced gene 283 protein; Nerve injury-induced gene 283 protein; NIN283; Rnf42; Zinc and ring finger 1; zinc and ring finger protein 1; zinc finger and ring finger protein 1; Zinc/RING finger protein 1; ZNRF 1; znrf1; ZNRF1_HUMAN; Zrfp1
Notification