Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD134 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-211 of mouse CD134 (NP_035789.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD134 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-211 of mouse CD134 (NP_035789.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Rat spleen, using CD134 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
| Cat.No | ADA-08187A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD134 |
| Target Synonyms | Ox40; ACT35; CD134; Ly-70; Txgp1; TXGP1L | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-211 of mouse CD134 (NP_035789.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP | Uniprot ID | P47741 |
Uniprot Id
P47741
Target Species
Mouse
Target Name
TNFRSF4
Target Full Name
Tumor necrosis factor receptor superfamily member 4
Target Function
Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in CD4(+) T-cells and in T-helper Th17 cells (at protein level).
Target Synonyms
Ox40; ACT35; CD134; Ly-70; Txgp1; TXGP1L
Target Background
Enables tumor necrosis factor-activated receptor activity. Involved in negative regulation of apoptotic process; positive regulation of B cell proliferation; and regulation of gene expression. Acts upstream of or within several processes, including cellular defense response; negative regulation of cytokine production; and regulation of protein kinase activity. Located in external side of plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 16. Orthologous to human TNFRSF4 (TNF receptor superfamily member 4).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
