Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Edf1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of mouse Edf1 (NP_067494.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Edf1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of mouse Edf1 (NP_067494.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14223A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EDF1 |
| Target Synonyms | MBF1; 0610008L11Rik; f1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of mouse Edf1 (NP_067494.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPKAK | Uniprot ID | Q9JMG1 |
Uniprot Id
Q9JMG1
Target Synonyms
MBF1; 0610008L11Rik; f1
Target Background
Predicted to enable TFIID-class transcription factor complex binding activity and transcription coactivator activity. Predicted to be involved in positive regulation of DNA binding activity. Predicted to act upstream of or within cell differentiation. Predicted to be located in cytosol; nucleolus; and nucleoplasm. Predicted to be active in nucleus. Is expressed in several structures, including central nervous system; genitourinary system; heart; liver; and retina. Orthologous to human EDF1 (endothelial differentiation related factor 1).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
