-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IFIT3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse IFIT3 (NP_034631.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IFIT3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse IFIT3 (NP_034631.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05893A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IFIT3 |
| Target Synonyms | P49; Ifi49; IFIT3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | COS-7, HT-29, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse IFIT3 (NP_034631.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YAWIYYHMGRLSEAQAYVDKVRQVCQKFANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQFSVDALKQAM | Uniprot ID | O14879 |
Uniprot Id
O14879
Target Species
Human
Target Name
IFIT3
Target Full Name
Interferon-induced protein with tetratricopeptide repeats 3
Target Function
IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exhibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin-dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2.
Target Subcellular Location
Cytoplasm. Mitochondrion.
Target Protein Families
IFIT family
Target Tissue Specificity
Expression significantly higher in peripheral blood mononuclear cells (PBMCs) and monocytes from systemic lupus erythematosus (SLE) patients than in those from healthy individuals (at protein level). Spleen, lung, leukocytes, lymph nodes, placenta, bone m
Target Research Area
Immunology
Target Synonyms
CIG 49; CIG49; GARG 49; IFI-60K; IFI60; IFI60K; IFIT-3; IFIT-4; Ifit3; IFIT3_HUMAN; IFIT4; Interferon induced 60 kDa protein; Interferon induced protein 60; Interferon induced protein with tetratricopeptide repeats 3; Interferon-induced 60 kDa protein; Interferon-induced protein with tetratricopeptide repeats 3; Interferon-induced protein with tetratricopeptide repeats 4; IRG2; ISG-60; ISG60; P60; Retinoic acid induced gene G protein; Retinoic acid-induced gene G protein; RIG G; RIG-G; RIGG; RP11-149I23.4
Target Background
Enables identical protein binding activity. Involved in negative regulation of apoptotic process; negative regulation of cell population proliferation; and response to virus. Located in cytosol and mitochondrion.
Notification