Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDHA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of mouse PDHA2 (NP_032837.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PDHA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of mouse PDHA2 (NP_032837.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04123A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDHA2 |
| Target Synonyms | Pdhal; PDHA2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of mouse PDHA2 (NP_032837.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | ISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDAAQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS | Uniprot ID | P35487 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
