-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HDAC9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC9 (Q9UKV0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against HDAC9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC9 (Q9UKV0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16781A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HDAC9 |
| Target Synonyms | HD7; HD9; HD7b; HDAC; HDRP; MITR; HDAC7; HDAC7B; HDAC9B; HDAC9FL; HDAC9 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, RD | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC9 (Q9UKV0). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELL | Uniprot ID | Q9UKV0 |
Uniprot Id
Q9UKV0
Target Species
Human
Target Name
HDAC9
Target Full Name
Histone deacetylase 9
Target Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Represses MEF2-dependent transcription.; Isoform 3 lacks active site residues and therefore is catalytically inactive. Represses MEF2-dependent transcription by recruiting HDAC1 and/or HDAC3. Seems to inhibit skeletal myogenesis and to be involved in heart development. Protects neurons from apoptosis, both by inhibiting JUN phosphorylation by MAPK10 and by repressing JUN transcription via HDAC1 recruitment to JUN promoter.
Target Involvement
A chromosomal aberration involving HDAC9 is found in a family with Peters anomaly. Translocation t(1;7)(q41;p21) with TGFB2 resulting in lack of HDAC9 protein.
Target Subcellular Location
Nucleus.
Target Protein Families
Histone deacetylase family, HD type 2 subfamily
Target Tissue Specificity
Broadly expressed, with highest levels in brain, heart, muscle and testis. Isoform 3 is present in human bladder carcinoma cells (at protein level).
Target Synonyms
HD 7; HD 7B; HD 9; HD7; HD7B; HD9; HDAC 7; HDAC 7B; HDAC 9; HDAC 9B; HDAC 9FL; HDAC; HDAC7; HDAC7B; HDAC9; HDAC9_HUMAN; HDAC9B; HDAC9FL; HDRP; Histone deacetylase 4/5 related protein; Histone deacetylase 7; Histone deacetylase 7B; Histone deacetylase 9; Histone deacetylase 9A ; Histone deacetylase related protein; Histone deacetylase-related protein; KIAA0744; MEF2 interacting transcription repressor MITR; MEF2 interacting transcription repressor protein; MEF2-interacting transcription repressor MITR; MITR
Target Background
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined.
Notification