-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against 14-3-3 Theta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 Theta (P27348) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against 14-3-3 Theta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 Theta (P27348) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16121A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 14-3-3 Theta |
| Target Synonyms | 1C5; HS1; 14-3-3; 14-3-3 Theta | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Mouse brain, Mouse testis, Rat testis, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 Theta (P27348). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL | Uniprot ID | P27348 |
Uniprot Id
P27348
Target Species
Human
Target Name
YWHAQ
Target Full Name
14-3-3 protein theta
Target Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Target Subcellular Location
Cytoplasm. Note=In neurons, axonally transported to the nerve terminals.
Target Protein Families
14-3-3 family
Target Tissue Specificity
Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression
Target Research Area
Neuroscience
Target Synonyms
14-3-3 protein T cell; 14-3-3 protein T-cell; 14-3-3 protein tau; 14-3-3 protein theta; 1433T_HUMAN; IC5; Protein HS1; Protein tau; YWHAQ tyrosine 3 monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; Ywhaq
Target Background
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.
Notification