-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against 15-PGDH/HPGD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-151 of human 15-PGDH/HPGD (P15428) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against 15-PGDH/HPGD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-151 of human 15-PGDH/HPGD (P15428) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13929A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 15-PGDH/HPGD |
| Target Synonyms | PGDH; PGDH1; PHOAR1; 15-PGDH; SDR36C1; 15-PGDH/HPGD | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-151 of human 15-PGDH/HPGD (P15428). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVY | Uniprot ID | P15428 |
Uniprot Id
P15428
Target Species
Human
Target Name
HPGD
Target Full Name
15-hydroxyprostaglandin dehydrogenase [NAD(+)]
Target Function
Primary enzyme catalyzing the conversion of hydroxylated arachidonic acid species to their corresponding oxidized metabolites (Probable). Prostaglandin inactivation, catalyzes the first step in the catabolic pathway of the prostaglandins. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. Converts 11(R)-HETE to 11-oxo-5,8,12,14-(Z,Z,E,Z)-eicosatetraenoic acid (ETE). Has hydroxylated docosahexaenoic acid metabolites as substrates. Converts resolvins E1, D1 and D2 to their oxo products which represents a mode of resolvins inactivation and stabilizes their anti-inflammatory actions.
Target Involvement
Hypertrophic osteoarthropathy, primary, autosomal recessive, 1 (PHOAR1); Cranioosteoarthropathy (COA); Isolated congenital nail clubbing (ICNC)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Target Tissue Specificity
Detected in colon epithelium (at protein level).
Target Synonyms
15 hydroxyprostaglandin dehydrogenase [NAD+]; 15 PGDH; 15-hydroxyprostaglandin dehydrogenase [NAD+]; 15-PGDH; 15PGDH; Hpgd; Hydroxyprostaglandin dehydrogenase 15 (NAD); NAD+ dependent 15 hydroxyprostaglandin dehydrogenase; OTTHUMP00000218960; OTTHUMP00000219016; OTTHUMP00000219018; PGDH; PGDH_HUMAN; PGDH1; PHOAR1; Prostaglandin dehydrogenase 1; SDR36C1; Short chain dehydrogenase/reductase family 36C member 1
Target Background
This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification