Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against A-RAF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 166-290 of human A-RAF (P10398) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against A-RAF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 166-290 of human A-RAF (P10398) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15847A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | A-RAF |
| Target Synonyms | PKS2; A-RAF; ARAF1; RAFA1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 166-290 of human A-RAF (P10398). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKK | Uniprot ID | P10398 |
Uniprot Id
P10398
Target Species
Human
Target Name
ARAF
Target Full Name
Serine/threonine-protein kinase A-Raf
Target Function
Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May also regulate the TOR signaling cascade.; Serves as a positive regulator of myogenic differentiation by inducing cell cycle arrest, the expression of myogenin and other muscle-specific proteins, and myotube formation.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily
Target Tissue Specificity
Predominantly in urogenital tissues.
Target Synonyms
A raf 1; A Raf proto oncogene serine/threonine protein kinase; ARAF 1; Araf; ARaf proto oncogene serine/threonine protein kinase; ARAF_HUMAN; ARAF1; Oncogene Araf1; Oncogene PKS2; PKS 2; PKS; PKS2; Proto oncogene Pks; Proto-oncogene A-Raf; Proto-oncogene A-Raf-1; Proto-oncogene Pks; RAFA 1; RAFA1; Ras binding protein DA Raf; Serine/threonine-protein kinase A-Raf; v raf murine sarcoma 3611 viral oncogene homolog; v raf murine sarcoma 3611 viral oncogene homolog 1; v raf oncogene homolog 1 (murine sarcoma 3611 virus)
Target Background
Enables protein serine/threonine kinase activity. Involved in negative regulation of apoptotic process; regulation of TOR signaling; and regulation of cellular protein metabolic process. Predicted to be active in cytosol and mitochondrion. Biomarker of high grade glioma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
