-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Alpha Fodrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alpha Fodrin (Q13813) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Alpha Fodrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alpha Fodrin (Q13813) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14138A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Alpha Fodrin |
| Target Synonyms | DEE5; NEAS; EIEE5; SPTA2; Alpha Fodrin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alpha Fodrin (Q13813). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIV | Uniprot ID | Q13813 |
Uniprot Id
Q13813
Target Species
Human
Target Name
SPTAN1
Target Full Name
Spectrin alpha chain, non-erythrocytic 1
Target Function
Fodrin, which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
Target Involvement
Epileptic encephalopathy, early infantile, 5 (EIEE5)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cell cortex.
Target Protein Families
Spectrin family
Target Research Area
Signal Transduction
Target Synonyms
(ALPHA)II-SPECTRIN; Alpha II Spectrin; Alpha-II spectrin; brain; EIEE5; FLJ17738; FLJ44613; Fodrin alpha chain; Fodrin, alpha; NEAS; Non erythrocytic spectrin alpha; non-erythroid alpha chain; SPECA; Spectrin alpha chain; Spectrin alpha chain brain; Spectrin alpha non erythrocytic 1; Spectrin; Spectrin non erythroid alpha chain; Spectrin, alpha, non-erythrocytic 1 (alpha-fodrin); Spectrin, nonerythroid, alpha subunit; Spna2; SPTA 2; SPTA2; SPTA2_HUMAN; SPTAN 1; SPTAN1
Target Background
Spectrins are a family of filamentous cytoskeletal proteins that function as essential scaffold proteins that stabilize the plasma membrane and organize intracellular organelles. Spectrins are composed of alpha and beta dimers that associate to form tetramers linked in a head-to-head arrangement. This gene encodes an alpha spectrin that is specifically expressed in nonerythrocytic cells. The encoded protein has been implicated in other cellular functions including DNA repair and cell cycle regulation. Mutations in this gene are the cause of early infantile epileptic encephalopathy-5. Alternate splicing results in multiple transcript variants.
Notification