Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Amylin/DAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-70 of human Amylin/DAP (NP_000406.1?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Amylin/DAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-70 of human Amylin/DAP (NP_000406.1?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
Western blot analysis of 293F-IAPP, using Amylin/DAP Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
| Cat.No | ADA-15456A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Amylin/DAP |
| Target Synonyms | DAP; IAP; Amylin/DAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F-IAPP | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 34-70 of human Amylin/DAP (NP_000406.1?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL | Uniprot ID | P10997 |
Uniprot Id
P10997
Target Species
Human
Target Name
IAPP
Target Full Name
Islet amyloid polypeptide
Target Function
Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
Target Subcellular Location
Secreted.
Target Protein Families
Calcitonin family
Target Research Area
Signal Transduction
Target Synonyms
Amylin; DAP; Diabetes associated peptide; Diabetes-associated peptide; IAP; IAPP; IAPP_HUMAN; Insulinoma amyloid peptide; Islet amyloid polypeptide (diabetes associated peptide, amylin); Islet amyloid polypeptide
Target Background
This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
