-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Apolipoprotein A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A1 (P02647) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Apolipoprotein A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A1 (P02647) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16515A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Apolipoprotein A1 |
| Target Synonyms | HPALP2; apo(a); Apolipoprotein A1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A1 (P02647). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLE | Uniprot ID | P02647 |
Uniprot Id
P02647
Target Species
Human
Target Name
APOA1
Target Full Name
Apolipoprotein A-I
Target Function
Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
Target Involvement
High density lipoprotein deficiency 2 (HDLD2); High density lipoprotein deficiency 1 (HDLD1); Amyloidosis 8 (AMYL8)
Target Subcellular Location
Secreted.
Target Protein Families
Apolipoprotein A1/A4/E family
Target Tissue Specificity
Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in carrier of the eNOSa/b
Target Synonyms
HPALP2; apo(a); APOA1
Target Background
This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein.
Notification