-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BUB3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human BUB3 (O43684) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against BUB3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human BUB3 (O43684) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16120A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BUB3 |
| Target Synonyms | BUB3L; hBUB3; BUB3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, C2C12, MCF7, Mouse liver, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BUB3 (O43684). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIR | Uniprot ID | O43684 |
Uniprot Id
O43684
Target Species
Human
Target Name
BUB3
Target Full Name
Mitotic checkpoint protein BUB3
Target Function
Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments. Promotes the formation of stable end-on bipolar attachments. Necessary for kinetochore localization of BUB1. Regulates chromosome segregation during oocyte meiosis. The BUB1/BUB3 complex plays a role in the inhibition of anaphase-promoting complex or cyclosome (APC/C) when spindle-assembly checkpoint is activated and inhibits the ubiquitin ligase activity of APC/C by phosphorylating its activator CDC20. This complex can also phosphorylate MAD1L1.
Target Subcellular Location
Nucleus. Chromosome, centromere, kinetochore.
Target Protein Families
WD repeat BUB3 family
Target Research Area
Cell Biology
Target Synonyms
Aa2-050; AU019800; AU021329; AU043350; AW146323; BUB 3; BUB 3L; BUB3 (budding uninhibited by benzimidazoles 3; yeast) homolog; bub3; BUB3 budding uninhibited by benzimidazoles 3 homolog; BUB3 mitotic checkpoint protein; BUB3_HUMAN; BUB3L; Budding uninhibited by benomyl; Budding uninhibited by benzimidazoles 3; Budding uninhibited by benzimidazoles 3 homolog (S. cerevisiae); Budding uninhibited by benzimidazoles 3 homolog (yeast); Budding uninhibited by benzimidazoles 3 homolog; Budding uninhibited by benzimidazoles 3; S. cerevisiae; homolog of; C78067; hBUB3; Mitotic checkpoint component; Mitotic checkpoint protein bub3; OTTHUMP00000020679; OTTHUMP00000020680; WD repeat type I transmembrane protein A72.5
Target Background
This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Notification