-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Calcineurin A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 422-521 of human Calcineurin A (Q08209) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Calcineurin A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 422-521 of human Calcineurin A (Q08209) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16789A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Calcineurin A |
| Target Synonyms | CALN; CCN1; CNA1; CALNA; DEE91; IECEE; PPP2B; ACCIID; CALNA1; IECEE1; Calcineurin A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, MCF7, Mouse brain, SH-SY5Y, U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 422-521 of human Calcineurin A (Q08209). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ | Uniprot ID | Q08209 |
Uniprot Id
Q08209
Target Species
Human
Target Name
PPP3CA
Target Full Name
Protein phosphatase 3 catalytic subunit alpha
Target Function
Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Many of the substrates contain a PxIxIT motif and/or a LxVP motif. In response to increased Ca(2+) levels, dephosphorylates and activates phosphatase SSH1 which results in cofilin dephosphorylation. In response to increased Ca(2+) levels following mitochondrial depolarization, dephosphorylates DNM1L inducing DNM1L translocation to the mitochondrion. Dephosphorylates heat shock protein HSPB1. Dephosphorylates and activates transcription factor NFATC1. In response to increased Ca(2+) levels, regulates NFAT-mediated transcription probably by dephosphorylating NFAT and promoting its nuclear translocation. Dephosphorylates and inactivates transcription factor ELK1. Dephosphorylates DARPP32. May dephosphorylate CRTC2 at 'Ser-171' resulting in CRTC2 dissociation from 14-3-3 proteins. Dephosphorylates transcription factor TFEB at 'Ser-211' following Coxsackievirus B3 infection, promoting nuclear translocation.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein. Cell membrane, sarcolemma. Cytoplasm, myofibril, sarcomere, Z line. Cell projection, dendritic spine.
Target Protein Families
PPP phosphatase family, PP-2B subfamily
Target Tissue Specificity
Expressed in keratinocytes (at protein level).
Target Synonyms
Alpha isoform formerly PPP2B; Calcineurin A alpha; Calcineurin A1; CalcineurinA; Calmodulin dependent calcineurin A subunit alpha isoform; Calmodulin-dependent calcineurin A subunit alpha isoform; CALN; CALNA 1; CALNA; CALNA1; CAM PRP catalytic subunit; CAM-PRP catalytic subunit; CCN 1; CCN1; CNA 1; CNA alpha; CNA; CNA1; PP2BA_HUMAN; PPP2B; Ppp3ca; Protein phosphatase 2B catalytic subunit ; Protein phosphatase 3 (formerly 2B) catalytic subunit alpha isoform; Protein phosphatase 3 catalytic subunit alpha isoform PPP3CA; Protein phosphatase 3 catalytic subunit alpha isozyme; Serine/threonine protein phosphatase 2B catalytic subunit alpha isoform; Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
Target Background
Enables several functions, including ATPase binding activity; calmodulin binding activity; and calmodulin-dependent protein phosphatase activity. Involved in several processes, including calcineurin-NFAT signaling cascade; peptidyl-serine dephosphorylation; and response to calcium ion. Located in several cellular components, including cytosol; dendritic spine; and nucleoplasm. Part of calcineurin complex. Colocalizes with cytoplasmic side of plasma membrane. Implicated in developmental and epileptic encephalopathy 91. Biomarker of focal segmental glomerulosclerosis and schizophrenia.
Notification