-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Carbonic Anhydrase 1 (CA1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human Carbonic Anhydrase 1 (CA1) (NP_001729.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Carbonic Anhydrase 1 (CA1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human Carbonic Anhydrase 1 (CA1) (NP_001729.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16062A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Carbonic Anhydrase 1 (CA1) |
| Target Synonyms | CAB; CA-I; Car1; HEL-S-11; Carbonic Anhydrase 1 (CA1) | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse spleen, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human Carbonic Anhydrase 1 (CA1) (NP_001729.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF | Uniprot ID | P00915 |
Uniprot Id
P00915
Target Species
Human
Target Name
CA1
Target Full Name
Carbonic anhydrase 1
Target Function
Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Alpha-carbonic anhydrase family
Target Research Area
Cardiovascular
Target Synonyms
CA 1; CA I; CA-I; CA1; CAB; CAH1_HUMAN; CAI; CAN; Car 1; Car1; Carbonate dehydratase I; Carbonic anhydrase 1; Carbonic anhydrase A; Carbonic anhydrase B; Carbonic anhydrase B; formerly; Carbonic anhydrase I; Carbonic dehydratase; ECK0125; JW0122; yadF
Target Background
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Notification