-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Claudin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 112-211 of human Claudin 1 (O95832) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Claudin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 112-211 of human Claudin 1 (O95832) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16998A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Claudin 1 |
| Target Synonyms | CLD1; SEMP1; ILVASC; Claudin 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-431, HepG2, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 112-211 of human Claudin 1 (O95832). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV | Uniprot ID | O95832 |
Uniprot Id
O95832
Target Species
Human
Target Name
CLDN1
Target Full Name
Claudin-1
Target Function
Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members play essential roles in the formation of impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN1 is required to prevent the paracellular diffusion of small molecules through tight junctions in the epidermis and is required for the normal barrier function of the skin. Required for normal water homeostasis and to prevent excessive water loss through the skin, probably via an indirect effect on the expression levels of other proteins, since CLDN1 itself seems to be dispensable for water barrier formation in keratinocyte tight junctions.; (Microbial infection) Acts as a co-receptor for hepatitis C virus (HCV) in hepatocytes. Associates with CD81 and the CLDN1-CD81 receptor complex is essential for HCV entry into host cell. Acts as a receptor for dengue virus.
Target Involvement
Ichthyosis-sclerosing cholangitis neonatal syndrome (NISCH)
Target Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.
Target Protein Families
Claudin family
Target Tissue Specificity
Strongly expressed in liver and kidney. Expressed in heart, brain, spleen, lung and testis.
Target Research Area
Signal Transduction
Target Synonyms
CLDN1; CLD1; SEMP1; UNQ481/PRO944; Claudin-1; Senescence-associated epithelial membrane protein
Target Background
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. Loss of function mutations result in neonatal ichthyosis-sclerosing cholangitis syndrome.
Notification