-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COX IV was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human COX IV (P13073) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against COX IV was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human COX IV (P13073) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16943A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COX IV |
| Target Synonyms | COX4; COXIV; COX4-1; COXIV-1; MC4DN16; COX IV-1; COX IV | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, MCF7, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human COX IV (P13073). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEW | Uniprot ID | P13073 |
Uniprot Id
P13073
Target Species
Human
Target Name
COX4I1
Target Full Name
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Target Function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunbit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Protein Families
Cytochrome c oxidase IV family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
AL024441; COX 4; COX IV 1; COX IV; COX IV-1; Cox4; COX41_HUMAN; Cox4a; COX4B; COX4I1; COX4I2; COX4L2; COXIV; Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit 4 isoform 1 mitochondrial; Cytochrome c oxidase subunit 4 isoform 1, mitochondrial; Cytochrome C Oxidase subunit IV; Cytochrome c oxidase subunit IV isoform 1; Cytochrome c oxidase subunit IV isoform 2 (lung); Cytochrome c oxydase subunit 4; dJ857M17.2; MGC105470; MGC72016
Target Background
Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. Pseudogenes related to this gene are located on chromosomes 13 and 14. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification