Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDAH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 186-285 of human DDAH1 (O94760) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DDAH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 186-285 of human DDAH1 (O94760) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13887A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDAH1 |
| Target Synonyms | DDAH; DDAHI; DDAH-1; HEL-S-16; DDAH1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Rat kidney, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 186-285 of human DDAH1 (O94760). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS | Uniprot ID | O94760 |
Uniprot Id
O94760
Target Species
Human
Target Name
DDAH1
Target Full Name
N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
Target Function
Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
Target Protein Families
DDAH family
Target Tissue Specificity
Detected in brain, liver, kidney and pancreas, and at low levels in skeletal muscle.
Target Research Area
Cardiovascular
Target Synonyms
DDAH; DDAH I; DDAH-1; DDAH1; DDAH1_HUMAN; DDAHI; Dimethylargininase 1; Dimethylargininase-1; Dimethylarginine dimethylaminohydrolase 1; N(G); N(G)-dimethylarginine dimethylaminohydrolase 1; NG NG dimethylarginine dimethylaminohydrolase
Target Background
This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
